PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10007352m
Common NameCARUB_v10007352mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family LBD
Protein Properties Length: 176aa    MW: 19073.9 Da    PI: 7.8397
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10007352mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260881.3e-27599196
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96
                     +C +Ck+l+ +C++ Cv  p+fp+ +  + + vh++FGa nv+k+l++l   ere+a++sl+y Aear rdP++G++g+il++q+ l+ l++++ +
  Carubv10007352m  5 PCGVCKILKITCEPTCVCKPHFPSGS-TRIQDVHQIFGAVNVHKILNSLGAAEREIAANSLCYAAEARRRDPIHGVHGMILHYQSILNDLEKDIIA 99
                     7**********************987.89***********************************************************99998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.2224104IPR004883Lateral organ boundaries, LOB
PfamPF031953.0E-26597IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MASKPCGVCK ILKITCEPTC VCKPHFPSGS TRIQDVHQIF GAVNVHKILN SLGAAEREIA  60
ANSLCYAAEA RRRDPIHGVH GMILHYQSIL NDLEKDIIAA MNTLATTVGS DQVPKYFDIP  120
IPNDFLATPA SLDSYIEKIK SLTTVEKNQL MQFWKRADGA SSSAGPSTAL GEKYQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545910.0AC254591.1 Capsella rubella clone CAP08-M12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285857.11e-130hypothetical protein CARUB_v10007352mg
SwissprotO496511e-63LBD32_ARATH; LOB domain-containing protein 32
TrEMBLR0H2631e-130R0H263_9BRAS; Uncharacterized protein
STRINGscaffold_702084.17e-74(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45251455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22700.16e-65LOB domain-containing protein 32